PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi4g24867.1.p
Common NameBRADI_4g24867
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 469aa    MW: 51674.5 Da    PI: 4.7594
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi4g24867.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS207.86.2e-641034652373
              GRAS   2 velLlecAeavssgdlelaqalLarlsel.....aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsP 89 
                       ++lLl+ Aeav++gd +la+a+ +rl  l      + +  ++ Rla +f+++L++rl++        +pp e      s++++++++ +e+sP
  Bradi4g24867.1.p 103 TDLLLTGAEAVEAGDSRLATAVFSRLDGLllgipENAAVGSFDRLAYHFAQGLRSRLSS----ANTRCPPPEP---LPSDRMSVQQIIQELSP 188
                       689***********************99888764445558******************9....2222333333...369999*********** PP

              GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlv 182
                       + kf+h+taNqaIl+a++g++ vH++D++i++G+QWp+L+  Las   g  s+ +T++   +  s +  ++ ++rL++fA++l++pf++n l 
  Bradi4g24867.1.p 189 FAKFAHFTANQAILDATKGDSDVHVVDLNIGEGVQWPSLMSDLASH--GGRSFHLTAIITDADYSYDVHQASARRLSEFADSLKLPFQYNSLR 279
                       ********************************************95..7789********8888***************************84 PP

              GRAS 183 akrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqe.adhnse......sFlerflealeyysalf 268
                           +d +l++++ + +  ++ ++    ++       l + r+ +  +vk l+Pk++v+ve+e +  ++e      sF++ f+eal++++++ 
  Bradi4g24867.1.p 280 I--HSDEDLHDFSKSCNGPVIFSCDTTSMTYK----LLGKLRTILPGCVKMLRPKLMVIVEEElVGIGKEasvcntSFVDFFFEALHHFTTVS 366
                       4..45556789988889999999998777765....34444445558***************96333444556666***************** PP

              GRAS 269 dsleaklpres..eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslv 359
                       +sl++ ++  +     + vEr ++g++i++ v + g    e +         le+ G  + ++s ++++qa++l+  ++ +g+ v +e+g lv
  Bradi4g24867.1.p 367 ESLASCFSGGNhgLCLRLVERDMVGPRIQDFVEHYGPVTLEPNA-----PGVLERYG--ACEMSASNVAQARMLVGLFN-RGFGVVHEKGRLV 451
                       ***99988888788999********************9444444.....67888877..678888999***********.************* PP

              GRAS 360 lgWkdrpLvsvSaW 373
                       l+Wk+r+L+svS+W
  Bradi4g24867.1.p 452 LCWKSRALTSVSVW 465
                       ************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098529.66676468IPR005202Transcription factor GRAS
PfamPF035142.1E-61103465IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 469 aa     Download sequence    Send to blast
METMSYPCSP LLSFPTHEEN NFVLWSPQVA LHEDATIHVD PSTHQLHDCG FLDTMALDYS  60
NDWHRQDASD VGMFIDCDER ILGQENGDLM AIQEELMEEN SLTDLLLTGA EAVEAGDSRL  120
ATAVFSRLDG LLLGIPENAA VGSFDRLAYH FAQGLRSRLS SANTRCPPPE PLPSDRMSVQ  180
QIIQELSPFA KFAHFTANQA ILDATKGDSD VHVVDLNIGE GVQWPSLMSD LASHGGRSFH  240
LTAIITDADY SYDVHQASAR RLSEFADSLK LPFQYNSLRI HSDEDLHDFS KSCNGPVIFS  300
CDTTSMTYKL LGKLRTILPG CVKMLRPKLM VIVEEELVGI GKEASVCNTS FVDFFFEALH  360
HFTTVSESLA SCFSGGNHGL CLRLVERDMV GPRIQDFVEH YGPVTLEPNA PGVLERYGAC  420
EMSASNVAQA RMLVGLFNRG FGVVHEKGRL VLCWKSRALT SVSVWAPI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-2014546541374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002449036.10.0hypothetical protein SORBIDRAFT_05g003820
TrEMBLI1INB50.0I1INB5_BRADI; Uncharacterized protein
STRINGBRADI4G24867.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP76843250
Representative plantOGRP8945915
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08250.11e-41GRAS family protein